Close

Magic™ Membrane Protein Human KCNC3 (Potassium voltage-gated channel subfamily C member 3) Expressed in Wheat germ for Antibody Discovery, Partial (671-757aa) (CAT#: MPX0059K)

This product is a 43 kDa Human KCNC3 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNC3
  • Protein Length
  • Partial (671-757aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 43 kDa
  • TMD
  • 6
  • Sequence
  • ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • KCNC3
  • Full Name
  • Potassium voltage-gated channel subfamily C member 3
  • Introduction
  • The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Alternate splicing results in several transcript variants.
  • Alternative Names
  • KV3.3; SCA13; KSHIIID; potassium voltage-gated channel subfamily C member 3; Shaw-related voltage-gated potassium channel protein 3; potassium channel, voltage gated Shaw related subfamily C, member 3; potassium voltage-gated channel, Shaw-related subfamily, member 3; voltage-gated potassium channel protein KV3.3; voltage-gated potassium channel subunit Kv3.3; KCNC3; Potassium voltage-gated channel subfamily C member 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us