Close
Close

Magic™ Membrane Protein Human KCND2 (Potassium voltage-gated channel subfamily D member 2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (406-630aa) (CAT#: MPX4461K)

Datasheet
This product is a 27.0kDa Human KCND2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCND2
  • Protein Length
  • Partial (406-630aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 27.0kDa
  • TMD
  • 6
  • Sequence
  • VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • KCND2
  • Full Name
  • Potassium voltage-gated channel subfamily D member 2
  • Introduction
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member mediates a rapidly inactivating, A-type outward potassium current which is not under the control of the N terminus as it is in Shaker channels.
  • Alternative Names
  • RK5; KV4.2; potassium voltage-gated channel subfamily D member 2; potassium channel, voltage gated Shal related subfamily D, member 2; voltage-gated potassium channel subunit Kv4.2; voltage-sensitive potassium channel; KCND2; Potassium voltage-gated channel subfamily D member 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us