Close
Close

Magic™ Membrane Protein Human KCNJ1 (Potassium inwardly rectifying channel subfamily J member 1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (178-391aa) (CAT#: MPX4351K)

Datasheet
This product is a 26.3kDa Human KCNJ1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNJ1
  • Protein Length
  • Partial (178-391aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 26.3kDa
  • TMD
  • 2
  • Sequence
  • ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • KCNJ1
  • Full Name
  • Potassium inwardly rectifying channel subfamily J member 1
  • Introduction
  • Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ROMK; ROMK1; KIR1.1; ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; inward rectifier K(+) channel Kir1.1; inwardly rectifying K+ channel; potassium channel, inwardly rectifying subfamily J member 1; potassium voltage-gated channel subfamily J member 1; KCNJ1; Potassium inwardly rectifying channel subfamily J member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us