Close

Magic™ Membrane Protein Human KIR2DS2 (Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3796K)

This product is a Human KIR2DS2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KIR2DS2
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KIR2DS2
  • Full Name
  • Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2
  • Introduction
  • Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene represents a haplotype-specific family member that encodes a protein with a short cytoplasmic tail. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • KIR2DS2; NKAT5; cl-49; CD158J; CD158b; NKAT-5; 183ActI; KIR2DL1; KIR-2DS2; killer cell immunoglobulin-like receptor 2DS2; CD158 antigen-like family member J; KIR2DS2 Killer-cell Immunoglobulin-like Receptor; MHC class I NK cell receptor; NK receptor 183 ActI; killer cell immunoglobulin-like receptor KIR2DS2; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2; killer-cell Ig-like receptor; killer-cell immunoglobulin-like receptor two domains short tail 2 protein; natural killer associated transcript 5; natural killer cell inhibitory receptor; p58 killer cell inhibitory receptor KIR-K7a; p58 natural killer cell receptor clone CL-49; Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us