Close
Close

Magic™ Membrane Protein Human KLRC3 (Killer cell lectin like receptor C3) Expressed in HEK293 for Antibody Discovery, Partial (98-240aa) (CAT#: MPX0390K)

Datasheet
This product is a 43 kDa Human KLRC3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRC3
  • Protein Length
  • Partial (98-240aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 43 kDa
  • TMD
  • 1
  • Sequence
  • EQN
    NSSPNARTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLQACASKNS
    SSLLCIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDS
    DHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • KLRC3
  • Full Name
  • Killer cell lectin like receptor C3
  • Introduction
  • Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • KLRC3; NKG2E; NKG2-E; NKG2-E type II integral membrane protein; NK cell receptor E; NKG2-E-activating NK receptor; killer cell lectin-like receptor subfamily C, member 3; Killer cell lectin like receptor C3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us