Close

Magic™ Membrane Protein Human LILRA5 (Leukocyte immunoglobulin like receptor A5) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (42-268aa) (CAT#: MPX4363K)

This product is a 27.2kDa Human LILRA5 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LILRA5
  • Protein Length
  • Partial (42-268aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 27.2kDa
  • TMD
  • 1
  • Sequence
  • GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • LILRA5
  • Full Name
  • Leukocyte immunoglobulin like receptor A5
  • Introduction
  • The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
  • Alternative Names
  • LILRA5; CD85; LIR9; CD85F; ILT11; LIR-9; ILT-11; LILRB7; leukocyte immunoglobulin-like receptor subfamily A member 5; CD85 antigen-like family member F; immunoglobulin-like transcript 11 protein; leucocyte Ig-like receptor A5; leukocyte Ig-like receptor 9; leukocyte immunoglobulin-like receptor 9; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; Leukocyte immunoglobulin like receptor A5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us