Close

Magic™ Membrane Protein Human LILRB4 (Leukocyte immunoglobulin like receptor B4) Expressed in NS0 for Antibody Discovery, Partial (17-257aa) (CAT#: MPX0480K)

This product is a 27 kDa Human LILRB4 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LILRB4
  • Protein Length
  • Partial (17-257aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 27 kDa
  • TMD
  • 1
  • Sequence
  • PRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQ
    GTLEAREYRLDKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYY
    RSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPM
    DTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHG
    FSHYLLSHPSDPLELIVSGSLEDPRPSPTRSVSTAAGPEDQPLMPTGSVP
    HSGLRRH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • LILRB4
  • Full Name
  • Leukocyte immunoglobulin like receptor B4
  • Introduction
  • This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. The receptor can also function in antigen capture and presentation. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • LILRB4; ILT3; LIR5; CD85K; ILT-3; LIR-5; leukocyte immunoglobulin-like receptor subfamily B member 4; CD85 antigen-like family member K; immunoglobulin-like transcript 3; leucocyte Ig-like receptor B4; leukocyte immunoglobulin-like receptor 5; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4; monocyte inhibitory receptor HM18; Leukocyte immunoglobulin like receptor B4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us