Close

Magic™ Membrane Protein Human LRBA (LPS responsive beige-like anchor protein) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1-251aa) (CAT#: MPX4459K)

This product is a 31.6kDa Human LRBA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LRBA
  • Protein Length
  • Partial (1-251aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 31.6kDa
  • TMD
  • 1
  • Sequence
  • MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • LRBA
  • Full Name
  • LPS responsive beige-like anchor protein
  • Introduction
  • The protein encoded by this gene is a member of the WDL-BEACH-WD (WBW) gene family. Its expression is induced in B cells and macrophages by bacterial lipopolysaccharides (LPS). The encoded protein associates with protein kinase A and may be involved in leading intracellular vesicles to activated receptor complexes, which aids in the secretion and/or membrane deposition of immune effector molecules. Defects in this gene are associated with the disorder common variable immunodeficiency-8 with autoimmunity. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • LRBA; BGL; LBA; CDC4L; CVID8; LAB300; lipopolysaccharide-responsive and beige-like anchor protein; CDC4-like protein; LPS-responsive vesicle trafficking, beach and anchor containing; vesicle trafficking, beach and anchor containing; LPS responsive beige-like anchor protein

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us