Close
Close

Magic™ Membrane Protein Human MTCH2 (Mitochondrial carrier 2) Expressed in wheat germ cell-free expression, Full Length (CAT#: MPX0825K)

Datasheet
This product is a Human MTCH2 membrane protein expressed in wheat germ cell-free expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MTCH2
  • Protein Length
  • Full Length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 59.7 kDa
  • TMD
  • 3
  • Sequence
  • MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI

Product Description

  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST tag at N-terminal
  • Protein Format
  • Soluble
  • Purity
  • >80% by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0

Target

  • Target Protein
  • MTCH2
  • Full Name
  • Mitochondrial carrier 2
  • Introduction
  • This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons.
  • Alternative Names
  • MTCH2; MIMP; HSPC032; SLC25A50; 2310034D24Rik; met-induced mitochondrial protein; solute carrier family 25, member 50; mitochondrial carrier homolog 2; Mitochondrial carrier 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us