Close
Close

Magic™ Membrane Protein Human NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1163K)

Datasheet
This product is a Human NDUFA13 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA13
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • AASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NDUFA13
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A13
  • Introduction
  • This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
  • Alternative Names
  • NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; CI-B16.6; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH-ubiquinone oxidoreductase B16.6 subunit; cell death regulatory protein GRIM-19; cell death-regulatory protein GRIM19; complex I B16.6 subunit; complex I-B16.6; gene associated with retinoic and IFN-induced mortality 19 protei; gene associated with retinoic and interferon-induced mortality 19 protein; NADH:ubiquinone oxidoreductase subunit A13

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us