Close

Magic™ Membrane Protein Human RHCE (Rh blood group CcEe antigens) Expressed in E.coli with 6xHis and KSI tag at the N-terminus for Antibody Discovery, Partial (379-417aa) (CAT#: MPX4119K)

This product is a 19.8 kDa Human RHCE membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RHCE
  • Protein Length
  • Partial (379-417aa)
  • Protein Class
  • Blood group antigen
  • Molecular Weight
  • 19.8 kDa
  • TMD
  • 11
  • Sequence
  • TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and KSI tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • RHCE
  • Full Name
  • Rh blood group CcEe antigens
  • Introduction
  • The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
  • Alternative Names
  • RHCE; RH; RHC; RHE; Rh4; RHNA; RHPI; RhVI; RH30A; RHIXB; RhVIII; CD240CE; RhIVb(J); RHCe(152N); blood group Rh(CE) polypeptide; (C)ces type 1 Rhesus blood group D antigen; RHCE blood group variant Crawford antigen Rh43; Rh blood group C antigen; Rh blood group CE antigen; Rh blood group CcEe antigen; Rh blood group D antigen; Rh blood group antigen Evans; Rh blood group protein; Rh polypeptide I; RhCE blood group antigens; Rhesus blood group CE protein; Rhesus blood group CcEe antigen; Rhesus blood group E antigen; Rhesus blood group Rhce antigen; Rhesus blood group antigen CE; Rhesus system C and E polypeptides; blood group RhCE polypeptide; blood group RhCcEe antigen; blood group protein RHCE; rh polypeptide 1; rhesus C/E antigens; rhesus blood group antigen, RhC antigen; rhesus blood group little e antigen; silenced Rh blood group CcEe antigen; truncated RHCE; truncated RhCcEe antigen; truncated RhD antigen; Rh blood group CcEe antigens

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us