Close

Magic™ Membrane Protein Human SEC61B (SEC61 translocon subunit beta) for Antibody Discovery (CAT#: MP0019Q)

This product is a 9.4 kDa Human SEC61B membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SEC61B
  • Protein Length
  • Partial
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 9.4 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSMPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purification
  • Conventional chromatography
  • Purity
  • >85% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 50% glycerol, 2mM DTT

Target

  • Target Protein
  • SEC61B
  • Full Name
  • SEC61 translocon subunit beta
  • Introduction
  • The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.
  • Alternative Names
  • OTTHUMP00000021784; Protein translocation complex beta; Sec61 beta subunit; Sec61 complex, Beta subunit; SEC61 translocon beta subunit; protein transport protein SEC61 beta subunit; Protein transport protein Sec61 subunit beta

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us