Close

Magic™ Membrane Protein Human SIRPA (Signal regulatory protein alpha) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (1-131aa) (CAT#: MPX4156K)

This product is a 21.5 kDa Human SIRPA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SIRPA
  • Protein Length
  • Partial (1-131aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.5 kDa
  • TMD
  • 1
  • Sequence
  • MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SIRPA
  • Full Name
  • Signal regulatory protein alpha
  • Introduction
  • The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene.
  • Alternative Names
  • SIRPA; BIT; MFR; P84; SIRP; MYD-1; SHPS1; CD172A; PTPNS1; tyrosine-protein phosphatase non-receptor type substrate 1; CD172 antigen-like family member A; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; inhibitory receptor SHPS-1; macrophage fusion receptor; myd-1 antigen; tyrosine phosphatase SHP substrate 1; Signal regulatory protein alpha

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us