Close
Close

Magic™ Membrane Protein Human SLC11A1 (Solute carrier family 11 member 1) for Antibody Discovery (CAT#: MP1143X)

Datasheet
This product is a 45.6 kDa Human SLC11A1 membrane protein expressed in In vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC11A1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 45.6 kDa
  • TMD
  • 12
  • Sequence
  • MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SLC11A1
  • Full Name
  • Solute carrier family 11 member 1
  • Introduction
  • This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
  • Alternative Names
  • LSH; NRAMP; NRAMP1; natural resistance-associated macrophage protein 1; NRAMP 1; solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1; solute carrier family 11 (sodium/phosphate symporters), member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us