Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Magic™ Membrane Protein Human SLC7A5 (Solute carrier family 7 member 5) Expressed in E.coli with 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (16-50aa)
"Creative Biolabs is committed to providing highly customized comprehensive solutions with the best quality to advance our global clients’ projects."
Magic™ Membrane Protein Human SLC7A5 (Solute carrier family 7 member 5) Expressed in E.coli with 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (16-50aa) (CAT#: MPX4142K)
This product is a 19.7 kDa Human SLC7A5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
SLC7A5
Protein Length
Partial (16-50aa)
Protein Class
Transporter
Molecular Weight
19.7 kDa
TMD
12
Sequence
AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Product Description
Expression Systems
E.coli
Tag
10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
Protein Format
Soluble
Purity
>90% as determined by SDS-PAGE
Buffer
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Target
Target Protein
SLC7A5
Full Name
Solute carrier family 7 member 5
Alternative Names
E16; CD98; LAT1; 4F2LC; MPE16; D16S469E; large neutral amino acids transporter small subunit 1; 4F2 light chain; CD98 light chain; L-type amino acid transporter 1; integral membrane protein E16; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; SLC7A5; Solute carrier family 7 member 5