Close

Magic™ Membrane Protein Human SLC8A1 (Solute carrier family 8 member A1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (396-627aa) (CAT#: MPX4338K)

This product is a 27.4kDa Human SLC8A1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC8A1
  • Protein Length
  • Partial (396-627aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 27.4kDa
  • TMD
  • 10
  • Sequence
  • VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SLC8A1
  • Full Name
  • Solute carrier family 8 member A1
  • Introduction
  • In cardiac myocytes, Ca(2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca(2+) concentration during contraction is primarily due to release of Ca(2+) from intracellular stores. However, some Ca(2+) also enters the cell through the sarcolemma (plasma membrane). During relaxation, Ca(2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca(2+) that entered across the sarcolemma must be extruded from the cell. The Na(+)-Ca(2+) exchanger is the primary mechanism by which the Ca(2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.
  • Alternative Names
  • NCX1; sodium/calcium exchanger 1; Na(+)/Ca(2+)-exchange protein 1; Na+/Ca++ exchanger; Na+/Ca2+ exchanger; solute carrier family 8 (sodium/calcium exchanger), member 1; solute carrier family 8 member 1; SLC8A1; Solute carrier family 8 member A1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us