Close

Magic™ Membrane Protein Human ST3GAL3 (ST3 beta-galactoside alpha-2,3-sialyltransferase 3) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (29-375aa) (CAT#: MPX4521K)

This product is a 54.9kDa Human ST3GAL3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST3GAL3
  • Protein Length
  • Partial (29-375aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 54.9kDa
  • TMD
  • 1
  • Sequence
  • KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ST3GAL3
  • Full Name
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • Introduction
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with a form of autosomal recessive nonsymdromic cognitive disability as well as infantile epileptic encephalopathy. Multiple transcript variants encoding several different isoforms have been found for this gene.
  • Alternative Names
  • ST3GAL3; ST3N; DEE15; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3Gal III; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; alpha 2,3-ST 3; alpha 2,3-sialyltransferase III; alpha-2,3-sialyltransferase II; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); sialyltransferase 6 (N-acetyllactosaminide alpha 2,3-sialyltransferase); ST3 beta-galactoside alpha-2,3-sialyltransferase 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us