Close

Magic™ Membrane Protein Human TGFB2 (Transforming growth factor beta 2, transcript variant 2) for Antibody Discovery (CAT#: MP1311J)

This product is a 25 kDa Human TGFB2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TGFB2
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 25 kDa
  • Sequence
  • ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Tag Free
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2

Target

  • Target Protein
  • TGFB2
  • Full Name
  • Transforming growth factor beta 2
  • Introduction
  • This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing.
  • Alternative Names
  • LDS4; G-TSF; TGF-beta2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us