Close

Magic™ Membrane Protein Human TMX3 (Thioredoxin related transmembrane protein 3) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (25-195aa) (CAT#: MPX4546K)

This product is a 35.6kDa Human TMX3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMX3
  • Protein Length
  • Partial (25-195aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 35.6kDa
  • TMD
  • 1
  • Sequence
  • KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TMX3
  • Full Name
  • Thioredoxin related transmembrane protein 3
  • Introduction
  • This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The canonical protein encoded by this gene has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This gene is expressed in many tissues but has its highest expression in heart and skeletal muscle. It is expressed in the retinal neuroepithelium and lens epithelium in the developing murine eye and haploinsufficiency of this gene in humans and zebrafish is associated with microphthalmia. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
  • Alternative Names
  • TMX3; PDIA13; TXNDC10; protein disulfide-isomerase TMX3; protein disulfide isomerase family A, member 13; thioredoxin domain containing 10; thioredoxin domain-containing protein 10; Thioredoxin related transmembrane protein 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us