Close

Magic™ Membrane Protein Human TNFRSF4 (TNF receptor superfamily member 4, 29-216aa) with C-hFc for Antibody Discovery (CAT#: MP1490J)

This product is a 46.8 kDa Human TNFRSF4 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF4
  • Protein Length
  • Partial (29-216aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 46.8 kDa
  • TMD
  • 1
  • Sequence
  • LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 1xPBS, pH 7.4

Target

  • Target Protein
  • TNFRSF4
  • Full Name
  • TNF receptor superfamily member 4
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
  • Alternative Names
  • ACT 35; ACT35; ACT35 antigen; ATC35 antigen; CD 134; CD134; CD134 antigen; IMD16; Lymphoid activation antigene ACT35; OX 40; OX40; OX40 antigen; OX40 cell surface antigen; OX40 homologue; OX40L receptor; TAX transcriptionally activated glycoprotein 1 receptor; TAX transcriptionally-activated glycoprotein 1 receptor; TNF receptor superfamily member 4; TNFRSF 4; TNFRSF4; TNR4_HUMAN; Tumor necrosis factor receptor superfamily member 4; Txgp 1l; Txgp1; Txgp1l

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us