Close

Magic™ Membrane Protein Human TNFSF13 (TNF superfamily member 13) for Antibody Discovery (CAT#: MP0027Q)

This product is a 16.3 kDa Human TNFSF13 membrane protein expressed in Hi-5 insect. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF13
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 16.3 kDa
  • TMD
  • 1
  • Sequence
  • AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Product Description

  • Expression Systems
  • Hi-5 insect
  • Tag
  • Tag Free
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2

Target

  • Target Protein
  • TNFSF13
  • Full Name
  • TNF superfamily member 13
  • Introduction
  • The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. in vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
  • Alternative Names
  • APRIL; CD256; TALL-2; TALL2; TNLG7B; TRDL-1; UNQ383/PRO715; ZTNF2; Furin; Dibasic-processing enzyme; Paired basic amino acid residue cleaving enzyme; PACE;

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us