Close

Magic™ Membrane Protein Human TNFSF13B (TNF superfamily member 13b) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (68-285aa) (CAT#: MPX4537K)

This product is a 39.7kDa Human TNFSF13B membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF13B
  • Protein Length
  • Partial (68-285aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 39.7kDa
  • TMD
  • 1
  • Sequence
  • QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TNFSF13B
  • Full Name
  • TNF superfamily member 13b
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
  • Alternative Names
  • TNFSF13B; DTL; BAFF; BLYS; CD257; TALL1; THANK; ZTNF4; TALL-1; TNLG7A; TNFSF20; tumor necrosis factor ligand superfamily member 13B; ApoL related ligand TALL-1; B-cell-activating factor; B-lymphocyte stimulator; Delta4 BAFF; TNF and ApoL-related leukocyte expressed ligand 1; TNF homolog that activates apoptosis; delta BAFF; dendritic cell-derived TNF-like molecule; epididymis secretory sperm binding protein; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor (ligand) superfamily, member 20; tumor necrosis factor ligand 7A; tumor necrosis factor superfamily member 13b; tumor necrosis factor-like protein ZTNF4; TNF superfamily member 13b

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us