Close

Magic™ Membrane Protein Human TNFSF8 (TNF superfamily member 8) Expressed in NS0 for Antibody Discovery, Partial (63-234aa) (CAT#: MPX0615K)

This product is a 22 kDa Human TNFSF8 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF8
  • Protein Length
  • Partial (63-234aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 22 kDa
  • TMD
  • 1
  • Sequence
  • QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWA
    YLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQ
    CPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQV
    NTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TNFSF8
  • Full Name
  • TNF superfamily member 8
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TNFSF8; CD153; CD30L; CD30LG; TNLG3A; tumor necrosis factor ligand superfamily member 8; CD153 antigen; CD30 antigen ligand; CD30 ligand; CD30-L; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand 3A; tumor necrosis factor superfamily member 8; TNF superfamily member 8

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us