Close
Close

Magic™ Membrane Protein Human TNFSF9 (TNF superfamily member 9) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (52-254aa) (CAT#: MPX4392K)

Datasheet
This product is a 25.3kDa Human TNFSF9 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF9
  • Protein Length
  • Partial (52-254aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.3kDa
  • TMD
  • 1
  • Sequence
  • PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TNFSF9
  • Full Name
  • TNF superfamily member 9
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
  • Alternative Names
  • TNFSF9; CD137L; TNLG5A; 4-1BB-L; tumor necrosis factor ligand superfamily member 9; 4-1BB ligand; 4-1BBL; CD137 ligand; homolog of mouse 4-1BB-L; receptor 4-1BB ligand; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand 5A; tumor necrosis factor superfamily member 9; TNF superfamily member 9

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us