Close

Magic™ Membrane Protein Human TREM2 (Triggering receptor expressed on myeloid cells 2) Expressed in E.coli with 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (19-174aa) (CAT#: MPX4205K)

This product is a 52.6 kDa Human TREM2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TREM2
  • Protein Length
  • Partial (19-174aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 52.6 kDa
  • TMD
  • 1
  • Sequence
  • HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TREM2
  • Full Name
  • Triggering receptor expressed on myeloid cells 2
  • Introduction
  • This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • TREM2; PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a; Triggering receptor expressed on myeloid cells 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us