Close

Magic™ Membrane Protein Human VIPR1 (Vasoactive intestinal peptide receptor 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3564K)

This product is a Human VIPR1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VIPR1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • VIPR1
  • Full Name
  • Vasoactive intestinal peptide receptor 1
  • Introduction
  • This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • VIPR1; II; HVR1; RDC1; V1RG; VIPR; VIRG; VAPC1; VPAC1; VPAC1R; VIP-R-1; VPCAP1R; PACAP-R2; PACAP-R-2; PACAP type II receptor; VIP and PACAP receptor 1; VIP receptor, type I; VPAC1 receptor; pituitary adenylate cyclase activating polypeptide receptor, type II; type 1 vasoactive intestinal peptide receptor; Vasoactive intestinal peptide receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us