Close
Close

Magic™ Membrane Protein Mouse Fxyd2 (FXYD domain-containing ion transport regulator 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0994K)

Datasheet
This product is a Mouse Fxyd2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Fxyd2
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • MAGEISDLSANSGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Fxyd2
  • Full Name
  • FXYD domain-containing ion transport regulator 2
  • Introduction
  • This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Multiple transcript variants have been described for this gene that are expressed in tissue-specific and developmental stage-specific patterns and encode proteins that differ at the N-terminus.
  • Alternative Names
  • Fxyd2; Atp1; Atp1g1; sodium/potassium-transporting ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; Na(+)/K(+) ATPase subunit gamma; sodium pump gamma chain; sodium/potassium-transporting ATPase gamma chain; FXYD domain-containing ion transport regulator 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us