Close

Magic™ Membrane Protein Mouse Tafa5 (TAFA chemokine like family member 5) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1123K)

This product is a Mouse Tafa5 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Tafa5
  • Protein Length
  • Full Length
  • Protein Class
  • Cytokine
  • Sequence
  • MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Tafa5
  • Full Name
  • TAFA chemokine like family member 5
  • Introduction
  • This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
  • Alternative Names
  • Tafa5; Tar; Fam19; Tafa-5; Tara-5; Fam19a5; chemokine-like protein TAFA-5; family with sequence similarity 19, member A5; protein FAM19A5; TAFA chemokine like family member 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us