Close
Close

Magic™ Recombinant Human CNR1 Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX59)

Datasheet
This product is recombinant Human CNR1 in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CNR1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 54.6 kDa
  • TMD
  • 7
  • Sequence
  • MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Product Description

  • Activity
  • Yes
  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Endotoxin
  • <1.0 EU per μg by the LAL method
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • CNR1
  • Full Name
  • Cannabinoid receptor 1
  • Introduction
  • This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
  • Alternative Names
  • CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5; cannabinoid receptor 1 (brain); central cannabinoid receptor; CNR1; Cannabinoid receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us