Close

Magic™ Recombinant Mouse Cd9 Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX146)

This product is recombinant Mouse Cd9 in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Cd9
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Product Description

  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • Cd9
  • Full Name
  • CD9 antigen
  • Introduction
  • Enables integrin binding activity. Involved in several processes, including myoblast fusion involved in skeletal muscle regeneration; paranodal junction assembly; and single fertilization. Acts upstream of or within negative regulation of cell population proliferation. Located in external side of plasma membrane and extracellular exosome. Is expressed in several structures, including alimentary system; axial skeleton; nervous system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in prostate adenocarcinoma. Orthologous to human CD9 (CD9 molecule).
  • Alternative Names
  • Tspan29; CD9 antigen

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us