Close

Magic™ Recombinant Mouse Ptges Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX89)

This product is recombinant Mouse Ptges in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Ptges
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 4
  • Sequence
  • MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Product Description

  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • Ptges
  • Full Name
  • Prostaglandin E synthase
  • Introduction
  • Enables prostaglandin-D synthase activity. Involved in prostaglandin biosynthetic process; regulation of fever generation; and sensory perception of pain. Acts upstream of or within negative regulation of cell population proliferation; positive regulation of prostaglandin secretion; and prostaglandin metabolic process. Located in cytoplasm and nuclear envelope lumen. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and sensory organ. Orthologous to human PTGES (prostaglandin E synthase).
  • Alternative Names
  • Pges; mPGES; mPGES-1; D2Ertd369e; 2410099E23Rik; prostaglandin E synthase; glutathione peroxidase PTGES; glutathione transferase PTGES; microsomal prostaglandin E synthase 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us