Close
Close

Magic™ Recombinant Mouse Sting1 Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX82)

Datasheet
This product is recombinant Mouse Sting1 in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Sting1
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • TMD
  • 4
  • Sequence
  • MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI

Product Description

  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • Sting1
  • Full Name
  • Stimulator of interferon response cGAMP interactor 1
  • Introduction
  • Enables 2',3'-cyclic GMP-AMP binding activity; cyclic-di-GMP binding activity; and ubiquitin protein ligase binding activity. Involved in several processes, including defense response to other organism; macroautophagy; and positive regulation of interferon-beta production. Acts upstream of or within cellular response to interferon-beta; positive regulation of transcription by RNA polymerase II; and regulation of inflammatory response. Located in several cellular components, including autophagosome; perinuclear region of cytoplasm; and peroxisome. Is expressed in ductus deferens; epididymis; ileum; and prostate gland. Human ortholog(s) of this gene implicated in STING-associated vasculopathy with onset in infancy. Orthologous to human STING1 (stimulator of interferon response cGAMP interactor 1).
  • Alternative Names
  • ERIS; MPYS; Mita; STING; Tmem173; STING-beta; 2610307O08Rik; stimulator of interferon genes protein; endoplasmic reticulum interferon stimulator; mediator of IRF3 activation; mitochondrial mediator of IRF3 activation; stimulator of interferon protein; transmembrane protein 173

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us