Close

Magic™ Recombinant Rat Pmp22 Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX61)

This product is recombinant Rat Pmp22 in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Rat
  • Target Protein
  • Pmp22
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Product Description

  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • Pmp22
  • Full Name
  • Peripheral myelin protein 22
  • Introduction
  • Predicted to enable cytoskeletal motor activity. Involved in several processes, including myelination; negative regulation of cell population proliferation; and negative regulation of neuron projection development. Located in bicellular tight junction and compact myelin. Is integral component of membrane. Biomarker of sciatic neuropathy. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease (multiple); Guillain-Barre syndrome; and hereditary neuropathy with liability to pressure palsies. Orthologous to human PMP22 (peripheral myelin protein 22).
  • Alternative Names
  • Gas-3; peripheral myelin protein 22; PMP-22; SAG; SR13 myelin protein; schwann cell membrane glycoprotein

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us