SLC17A7 Membrane Protein Introduction

Introduction of SLC17A7

Solute carrier family 17 member 7 (SLC17A7), also known as Vesicular glutamate transporter 1 (VGLUT1), is a protein encoded by the SLC17A7 gene in humans. In the presynaptic nerve endings of excitatory nerve cells, the absorption of glutamate is converted into synaptic vesicles. It is also possible to regulate the transport of inorganic phosphates. The vesicular glutamate transporter (VGLUT) is an active transporter responsible for the storage of vesicles in synaptic vesicles and plays an important role in the neurotransmission of glutamate. VGLUT1, VGLUT2, and VGLUT3 make up VGLUT.

Basic Information of SLC17A7
Protein Name	Vesicular glutamate transporter 1 (VGluT1)
Gene Name	SLC17A7
Aliases	Brain-specific Na(+)-dependent inorganic phosphate cotransporter, Solute carrier family 17 member 7
Organism	Homo sapiens (Human)
UniProt ID	Q9P2U7
Transmembrane Times	12
Length (aa)	560
Sequence	MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY

Function of SLC17A7 Protein

The protein encoded by this gene is a vesicle, a sodium-dependent phosphate transporter that is clearly expressed in the brain-rich regions of the brain. It is preferentially involved in the function of cell membranes and glutamate transport in synaptic vesicles. SLC17A7 and its associated indistinguishable inorganic phosphate transporter have 82% properties and appear to form a unique class in the Na⁺/Pi co transport family. In the current study, VGLUT1 was expressed in insect cells, dissolved, purified to near homogeneity, and its transport activity was studied. The retinal membrane contains two VGLUT1 moieties with a distinct molecular mass of 65 and 57 kDa. The VGLUT1-specific antibody against the inserted 25 amino acid residue sequence recognizes a 65-kDa immunologically active polypeptide.

SLC17A7 Membrane Protein Introduction Fig.1 The structure of SLC17A7 protein.

Application of SLC17A7 Protein in Literature

Hasegawa H., et al. The effects of unilateral cochlear ablation on the expression of vesicular glutamate transporter 1 in the lower auditory pathway of neonatal rats. Auris Nasus Larynx. 2017,44. PubMed ID: 28238468

These results suggest that unilateral cochlear ablation affects VGLUT1 expression in the central auditory pathway, not only on the lateral side but also on the contralateral side.
Moriyama S., et al. Function and expression of a splicing variant of vesicular glutamate transporter 1. Biochimica et Biophysica Acta (BBA) - Biomembranes. 2017 (1859.5):931-940. PubMed ID: 28188742

These results indicate that VGLUT1v is present in a functional state in mouse photoreceptor cells and is involved in the chemical transport of glutamine.
Madura S. A., et al. Genetic variation in SLC17A7 promoter associated with response to sport-related concussions. Brain Injury. 2016 (30.7):1. PubMed ID: 27029226

This study demonstrates for the first time the link between the genetic polymorphism of the rs7417284 SNP in the promoter region of the SLC17A7 gene and the severity and duration of concussion.
Wang H. S., et al. Changes in VGLUT1 and VGLUT2 expression in rat dorsal root ganglia and spinal cord following spared nerve injury. Neurochemistry International. 2016 (99):9-15. PubMed ID: 27210824.

The authors observed that VGLUT2 were selectively upregulated in crude vesicle fractions from the ipsilateral lumbar enlargement on postoperative days 7 and 14, while VGLUT1 was transiently downregulated in ipsilateral DRG (day 4) and contralateral lumbar enlargement (day 1).
Pan P.Y., Vesicular Glutamate Transporter 1 Orchestrates Recruitment of Other Synaptic Vesicle Cargo Proteins during Synaptic Vesicle Recycling. The Journal of Biological Chemistry. 2015 (290.37): 22593–22601. PubMed ID: 26224632

This article reveals that VGLUT1 has a great influence on the retrieval kinetics of half of the known SV cargos, especially weakening the endocytosis of glutamine, which in turn slows the speed of other SV cargos, proving the retrieval of goods.

SLC17A7 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC17A3 antibody development services.

Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: