MFS-type transporter SLC18B1, also known as Solute carrier family 18 member B1(SLC18B1), is a transmembrane protein encoded by the SLC18B1 gene in humans. SLC18B1 is the fourth member of SLC18 transporter family, including vesicular monoamine transporter protein and vesicular acetylcholine transporter protein. Protein liposomes containing purified human SLC18B1 protein actively transship arginine and imine by exchanging H+. SLC18B1 is mainly expressed in the hippocampus and is associated with vesicles in astrocytes. The knockdown of SLC18B1 gene reduced the content of SLC18B1 protein and arginine/imine in astrocytes.
Basic Information of SLC18B1 | |
Protein Name | MFS-type transporter SLC18B1 |
Gene Name | SLC18B1 |
Aliases | Solute carrier family 18 member B1 |
Organism | Homo sapiens (Human) |
UniProt ID | Q6NT16 |
Transmembrane Times | 12 |
Length (aa) | 456 |
Sequence | MEALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVLDRVPDGPVFIAMCFLVRVMDAVSFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQSFGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGEHSFWKLIALPKVGLIAFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDKRPPLRKWLLVFGNLITAGCYMLLGPVPILHIKSQLWLLVLILVVSGLSAGMSIIPTFPEILSCAHENGFEEGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLYEKIGFEWAAAIQGLWALISGLAMGLFYLLEYSRRKRSKSQNILSTEEERTTLLPNET |
SLC18B1 encodes a vesicular polyamine transporter, which expresses human SLC18B1 protein in HIGH FIVE cells. SLC18B1 is dissolved from the membrane with detergent, and purified by NI-NTA column chromatography. The purified and heterogeneously expressed SLC18B1 protein was recombined with the bacterial F-ATPase to form a liposome, and the uptake of the radial polyamine was measured. The SLC18B1 protein is a polyamine transporter, so it is necessary to confirm that the v-mat and VAChT do not transport polyamines. The SLC18B1 gene is widely expressed in various organs including the lung, placenta, adrenal gland, liver and brain.
Fig.1 The structure of MFS-type transporter SLC18B1.
These results suggest that a vesicular polyamine transporter (VPAT) is encoded by SLC18B1 gene in humans.
This study reveals that within the Major Facilitator Superfamily (MFS, TCID 2.A.1), SLC18 family is a part of the drugs of H+ Antiporter-1 Family (DHA1, TCID 2.A.1.2).
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC18B1 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.