Close

Magic™ Membrane Protein Human ACVR1B (Activin A receptor type 1B) Expressed in NS0 for Antibody Discovery, Partial (32-126aa) (CAT#: MPX0265K)

This product is a 37.5 kDa Human ACVR1B membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACVR1B
  • Protein Length
  • Partial (32-126aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 37.5 kDa
  • TMD
  • 1
  • Sequence
  • LLCACTSCLQANYTCETDG
    ACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDY
    CNRIDLRVPSGHLKEPEHPSMWGPVE

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ACVR1B
  • Full Name
  • Activin A receptor type 1B
  • Introduction
  • This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • ACVR1B; ALK4; SKR2; ACTRIB; ACVRLK4; activin receptor type-1B; activin A receptor, type IB; activin A receptor, type II-like kinase 4; activin receptor-like kinase 4; serine/threonine-protein kinase receptor R2; Activin A receptor type 1B
  • Gene ID
  • 91

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us