Close

Magic™ Membrane Protein Human APOO (Apolipoprotein O) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1265K)

This product is a Human APOO membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • APOO
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • KKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • APOO
  • Full Name
  • Apolipoprotein O
  • Introduction
  • This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.
  • Alternative Names
  • APOO; MIC26; Mic23; My025; FAM121B; MICOS26; MICOS complex subunit MIC26; MICOS complex subunit MIC23; brain my025; family with sequence similarity 121B; mitochondrial contact site and cristae organizing system subunit 26; Apolipoprotein O

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us