Close

Magic™ Membrane Protein Human ATP4B (ATPase H+/K+ transporting subunit beta) Expressed in E.coli with Tag-Free for Antibody Discovery, Partial (58-291aa) (CAT#: MPX4298K)

This product is a 26.6kDa Human ATP4B membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP4B
  • Protein Length
  • Partial (58-291aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 26.6kDa
  • TMD
  • 1
  • Sequence
  • CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Tag-Free
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ATP4B
  • Full Name
  • ATPase H+/K+ transporting subunit beta
  • Introduction
  • The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
  • Alternative Names
  • ATP4B; ATP6B; potassium-transporting ATPase subunit beta; ATPase H+/K+ transporting beta subunit; ATPase, H+/K+ exchanging, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide; gastric H(+)/K(+) ATPase subunit beta; gastric H+/K+ ATPase beta subunit; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; proton pump beta chain; ATPase H+/K+ transporting subunit beta

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us