Close
Close

Magic™ Membrane Protein Human ATP5G3 (ATP synthase membrane subunit c locus 3) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1002K)

Datasheet
This product is a Human ATP5G3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP5G3
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 2
  • Sequence
  • DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ATP5G3
  • Full Name
  • ATP synthase membrane subunit c locus 3
  • Introduction
  • This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding different proteins have been identified.
  • Alternative Names
  • ATP5G3; P3; ATP5G3; ATP synthase F(0) complex subunit C3, mitochondrial; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proteolipid P3; ATP synthase proton-transporting mitochondrial F(0) complex subunit C3; ATP synthase subunit 9; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9); ATP synthase, H+ transporting, mitochondrial Fo complex subunit C3 (subunit 9); ATP synthase, mitochondrial, C subunit-3; ATPase protein 9; ATPase subunit C; dicyclohexylcarbodiimide (DCCD)-reactive proteolipid subunit; ATP synthase membrane subunit c locus 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us