Close
Close

Magic™ Membrane Protein Human ATP6V0C (ATPase H+ transporting V0 subunit c) for Antibody Discovery (CAT#: MP0098X)

Datasheet
This product is a 42.1 kDa Human ATP6V0C membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0C
  • Protein Length
  • Full-length
  • Molecular Weight
  • 42.1 kDa
  • TMD
  • 4
  • Sequence
  • MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • ATP6V0C
  • Full Name
  • ATPase H+ transporting V0 subunit c
  • Introduction
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17
  • Alternative Names
  • ATP6C; ATP6L; ATPL; VATL; Vma3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD; ATPase, H+ transporting, lysosomal 16kD; V0 subunit c; ATPase, H+ transporting, lysosomal, 16-KD; ATPase, H+ transporting, lysosomal; V0 subunit c; H(+)-transporting two-sector ATPase, 16 kDa sub

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us