Close

Magic™ Membrane Protein Human ATP6V0C (ATPase H+ transporting V0 subunit c) Full Length (CAT#: MPC0415K) Made to Order

This product is a 15.7 kDa Human ATP6V0C membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0C
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion Transporter
  • Molecular Weight
  • 15.7 kDa
  • TMD
  • 4
  • Sequence
  • MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPE
    QIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG
    LSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAL
    ILSTK

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ATP6V0C
  • Full Name
  • ATPase H+ transporting V0 subunit c
  • Introduction
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17.
  • Alternative Names
  • ATPL; VATL; VPPC; Vma3; ATP6C; ATP6L; V-type proton ATPase 16 kDa proteolipid subunit; ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c; H(+)-transporting two-sector ATPase, 16 kDa subunit; V-ATPase 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; ATP6V0C; ATPase H+ transporting V0 subunit c

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us