Close

Magic™ Membrane Protein Human B4GALT2 (Beta-1,4-galactosyltransferase 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3859K)

This product is a Human B4GALT2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • B4GALT2
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • B4GALT2
  • Full Name
  • Beta-1,4-galactosyltransferase 2
  • Introduction
  • This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Three transcript variants encoding two different isoforms have been found for this gene.
  • Alternative Names
  • B4GALT2; B4Gal-T2; B4Gal-T3; beta4Gal-T2; N-acetyllactosamine synthase; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2; beta-1,4-GalTase 2; beta-4-GalT2; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2; beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase; lactose synthase A protein; nal synthase; Beta-1,4-galactosyltransferase 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us