Close

Magic™ Membrane Protein Human CD247 (CD247 molecule) without tag for Antibody Discovery (CAT#: MP0186X)

This product is a 18.7 kDa Human CD247 membrane protein expressed in in vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD247
  • Protein Length
  • Full-length
  • Molecular Weight
  • 18.7 kDa
  • TMD
  • 1
  • Sequence
  • MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • NO
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • CD247
  • Full Name
  • CD247 molecule
  • Introduction
  • The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene
  • Alternative Names
  • CD3-ZETA; CD3H; CD3Q; CD3Z; T3Z; TCRZ; CD247 antigen, zeta subunit; CD3Z antigen, zeta polypeptide (TiT3 complex); OTTHUMP00000032544; T-cell antigen receptor complex; zeta subunit of CD3; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface glycoprotein CD3 zeta chain

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us