Close

Magic™ Membrane Protein Human CD44 (CD44 molecule (Indian blood group)) Expressed in NS0 for Antibody Discovery, Partial (21-220aa) (CAT#: MPX0270K)

This product is a 48.6 kDa Human CD44 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD44
  • Protein Length
  • Partial (21-220aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 48.6 kDa
  • TMD
  • 1
  • Sequence
  • QIDLNITCRFAGVFHVEKNGRYSISRTEAA
    DLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAAN
    NTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR
    DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFST
    VHPIPDEDSPWITDSTDRIP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD44
  • Full Name
  • CD44 molecule (Indian blood group)
  • Introduction
  • The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
  • Alternative Names
  • CD44; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III; CD44 antigen; GP90 lymphocyte homing/adhesion receptor; Hermes antigen; Indian blood group antigen; cell surface glycoprotein CD44; chondroitin sulfate proteoglycan 8; epican; extracellular matrix receptor III; hematopoietic cell E- and L-selectin ligand; heparan sulfate proteoglycan; homing function and Indian blood group system; hyaluronate receptor; phagocytic glycoprotein 1; soluble CD44; CD44 molecule (Indian blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us