Close

Magic™ Membrane Protein Human CLCA1 (Chloride channel accessory 1) Expressed in Wheat germ for Antibody Discovery, Partial (677-776aa) (CAT#: MPX0056K)

This product is a 37 kDa Human CLCA1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLCA1
  • Protein Length
  • Partial (677-776aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 37 kDa
  • Sequence
  • ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.3% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • CLCA1
  • Full Name
  • Chloride channel accessory 1
  • Introduction
  • This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
  • Alternative Names
  • CACC; GOB5; CACC1; CLCRG1; CaCC-1; hCLCA1; hCaCC-1; calcium-activated chloride channel regulator 1; CLCA family member 1, chloride channel regulato; calcium-activated chloride channel family member 1; calcium-activated chloride channel protein 1; calcium-dependent chloride channel-1; chloride channel regulator 1; chloride channel, calcium activated, family member 1; CLCA1; Chloride channel accessory 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us