Close

Magic™ Membrane Protein Human CLDN3 (Claudin 3) Expressed in E.coli with 6xHis and B2M tag at the N-terminus for Antibody Discovery, Partial (30-80aa) (CAT#: MPX4295K)

This product is a 19.7kDa Human CLDN3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN3
  • Protein Length
  • Partial (30-80aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.7kDa
  • TMD
  • 4
  • Sequence
  • RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and B2M tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CLDN3
  • Full Name
  • Claudin 3
  • Introduction
  • Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat.
  • Alternative Names
  • CLDN3; RVP1; HRVP1; C7orf1; CPE-R2; CPETR2; claudin-3; CPE-R 2; CPE-receptor 2; Clostridium perfringens enterotoxin receptor 2; ventral prostate.1 protein homolog; ventral prostate.1-like protein; Claudin 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us