Close
Close

Magic™ Membrane Protein Human CNMD (Chondromodulin) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (215-334aa) (CAT#: MPX4583K)

Datasheet
This product is a 29.8kDa Human CNMD membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CNMD
  • Protein Length
  • Partial (215-334aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 29.8kDa
  • TMD
  • 1
  • Sequence
  • EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CNMD
  • Full Name
  • Chondromodulin
  • Introduction
  • This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • CNMD; CHM1; CHM-I; LECT1; BRICD3; MYETS1; leukocyte cell-derived chemotaxin 1; BRICHOS domain containing 3; chondromodulin-1; chondromodulin-I; leukocyte cell derived chemotaxin 1; multiple myeloma tumor suppressor 1; Chondromodulin

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us