Close
Close

Magic™ Membrane Protein Human COX5A (Cytochrome c oxidase subunit 5A) Expressed in E.coli for Antibody Discovery, Partial (42-150aa) (CAT#: MPX0112K)

Datasheet
This product is a 15 kDa Human COX5A membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX5A
  • Protein Length
  • Partial (42-150aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 15 kDa
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • > 95% SDS-PAGE
  • Buffer
  • pH: 8.00, Constituents: 0.03% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride

Target

  • Target Protein
  • COX5A
  • Full Name
  • Cytochrome c oxidase subunit 5A
  • Introduction
  • Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22.
  • Alternative Names
  • COX5A; VA; COX; COX-VA; MC4DN20; cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase polypeptide Va; cytochrome c oxidase polypeptide, mitochondrial; cytochrome c oxidase subunit Va; mitochondrial cytochrome c oxidase subunit Va; Cytochrome c oxidase subunit 5A

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us