Close

Magic™ Membrane Protein Human COX6C (Cytochrome c oxidase subunit 6C) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0999K)

This product is a Human COX6C membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX6C
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • APEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • COX6C
  • Full Name
  • Cytochrome c oxidase subunit 6C
  • Introduction
  • Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12.
  • Alternative Names
  • COX6C; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein; epididymis secretory sperm binding protein; Cytochrome c oxidase subunit 6C

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us