Close

Magic™ Membrane Protein Human COX7A1 (Cytochrome c oxidase subunit 7A1) Full Length (CAT#: MPC2158K) Made to Order

This product is a 9.1 kDa Human COX7A1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX7A1
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 9.1 kDa
  • TMD
  • 1
  • Sequence
  • MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDN
    ILYRVTMTLCLGGTVYSLYSLGWASFPRN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX7A1
  • Full Name
  • Cytochrome c oxidase subunit 7A1
  • Introduction
  • Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.
  • Alternative Names
  • COX7A1; COX7A; COX7AH; COX7AM; cytochrome c oxidase subunit 7A1, mitochondrial; cytochrome c oxidase subunit VIIa polypeptide 1 (muscle); cytochrome c oxidase subunit VIIa-H; cytochrome c oxidase subunit VIIa-M; cytochrome c oxidase subunit VIIa-heart; cytochrome c oxidase subunit VIIa-muscle; Cytochrome c oxidase subunit 7A1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us